Lamin B1 Antibody - BSA Free

Images

 
Biological Strategies: Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 ...read more
Biological Strategies: Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37c ...read more
Immunoprecipitation: Lamin B1 Antibody [NBP3-03711] - Analysis of 300ug extracts of MCF7 cells using 3ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilition of ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of U2OS cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: ...read more
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear ...read more
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation of Lamin B1 in 300 ug extracts from Jurkat cells using 0.5 ug Lamin B1 Rabbit pAb . Western blot analysis was performed using ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of C6 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated ...read more
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation was performed with cross-linked chromatin from HeLa, using Lamin-B1 Rabbit mAb and rabbit IgG. The amount ...read more
Chromatin Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Lamin B1 Rabbit pAb antibody and rabbit IgG.The amount of ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Confocal immunofluorescence analysis of HeLa cells using Lamin B1 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear ...read more
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Lamin B1 Rabbit pAb at dilution of 1:150 (40x lens). High pressure antigen ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of PC-12 cells using Lamin B1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: ...read more
Immunoprecipitation: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Lamin B1 antibody . Western blot was performed from the immunoprecipitate ...read more
Western Blot: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Western blot analysis of various lysates using Lamin B1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody - Azide and BSA Free [Lamin B1] - Immunofluorescence analysis of NIH/3T3 cells using Lamin B1 Rabbit pAb at dilution of 1:100. Secondary antibody: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
   

Biological Strategies

     

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Lamin B1 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1). RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Lamin B1 Antibody - BSA Free

  • ADLD
  • Lamin B1
  • lamin-B1
  • LMN
  • LMN2
  • LMNB
  • LMNB1
  • MGC111419

Background

Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74451
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1436
Species: Mu
Applications: WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-62573
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Lamin B1 Antibody (NBP3-03711) (0)

There are no publications for Lamin B1 Antibody (NBP3-03711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B1 Antibody (NBP3-03711) (0)

There are no reviews for Lamin B1 Antibody (NBP3-03711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lamin B1 Antibody (NBP3-03711). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Secondary Antibodies

 

Isotype Controls

Additional Lamin B1 Products

Research Areas for Lamin B1 Antibody (NBP3-03711)

Find related products by research area.

Blogs on Lamin B1

There are no specific blogs for Lamin B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LMNB1