LAG-3 Antibody

Images

 
Immunohistochemistry-Paraffin: LAG-3 Antibody [NBP1-85781] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: LAG-3 Antibody [NBP1-85781] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LAG-3 Antibody [NBP1-85781] - Staining in human tonsil and cerebral cortex tissues using anti-LAG3 antibody. Corresponding LAG3 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LAG-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQ
Specificity
Specificity of human LAG-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAG-3 Protein (NBP1-85781PEP)
Publications
Read Publications using NBP1-85781.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAG-3 Antibody

  • CD223 antigen
  • CD223
  • FDC
  • LAG3
  • LAG-3
  • lymphocyte activation gene 3 protein
  • lymphocyte-activation gene 3
  • Protein FDC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF123
Species: Hu
Applications: WB, Block, ICC
6507-IL/CF
Species: Hu
NBP1-97657
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF470
Species: Mu
Applications: WB, IHC, Neut
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready

Publications for LAG-3 Antibody (NBP1-85781)(2)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for LAG-3 Antibody (NBP1-85781) (0)

There are no reviews for LAG-3 Antibody (NBP1-85781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LAG-3 Antibody (NBP1-85781). (Showing 1 - 4 of 4 FAQs).

  1. What is the concentration of your biotin conjugated LAG-3 antibody?
    • We actuall do not determine the concentration of our conjugated antibodies but they are usuall 80-100% the concentration of the base product, so the concentration should be at least 0.8 mg/ml.
  2. Can this LAG-3 antibody be used in ELISA?
    • We have not validated this particular LAG-3 antibody for ELISA in mouse; however, it has been cited as being used as a detection antibody in a publicatoin (PMID 15946792).
  3. I'm using your LAG-3 antibody in western blot but the observed band is a different size than the predicted band size, do you know what the bands are?
    • There are several alternative splice varients of LAG-3 that could explain the different sized proteins stained by the LAG-3 antibody. It is also believed that there are two secreted forms of LAG-3, one that is about 36 kDa and another at 52 kDa.
  4. Is this LAG-3 antibody offered in a smaller size that is less expensive?
    • We do not offer a sample size for this particular LAG 3 antibody but we do offer another, AF3329, in a 25 ug sample size.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LAG-3 Products

Bioinformatics Tool for LAG-3 Antibody (NBP1-85781)

Discover related pathways, diseases and genes to LAG-3 Antibody (NBP1-85781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAG-3 Antibody (NBP1-85781)

Discover more about diseases related to LAG-3 Antibody (NBP1-85781).
 

Pathways for LAG-3 Antibody (NBP1-85781)

View related products by pathway.

PTMs for LAG-3 Antibody (NBP1-85781)

Learn more about PTMs related to LAG-3 Antibody (NBP1-85781).
 

Research Areas for LAG-3 Antibody (NBP1-85781)

Find related products by research area.

Blogs on LAG-3

There are no specific blogs for LAG-3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAG-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAG3