Lactate Dehydrogenase C Antibody


Western Blot: Lactate Dehydrogenase C Antibody [NBP1-54798] - NTERA2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

Lactate Dehydrogenase C Antibody Summary

Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LDHC and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lactate Dehydrogenase C Antibody

  • Cancer/testis antigen 32
  • CT32EC
  • EC 1.1.1
  • lactate dehydrogenase C
  • lactate dehydrogenase C4
  • LDH testis subunit
  • LDH3MGC111073
  • LDH-C
  • LDHX
  • LDH-X
  • L-lactate dehydrogenase C chain


Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Lactate Dehydrogenase C Antibody (NBP1-54798) (0)

There are no publications for Lactate Dehydrogenase C Antibody (NBP1-54798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactate Dehydrogenase C Antibody (NBP1-54798) (0)

There are no reviews for Lactate Dehydrogenase C Antibody (NBP1-54798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lactate Dehydrogenase C Antibody (NBP1-54798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Lactate Dehydrogenase C Products

Bioinformatics Tool for Lactate Dehydrogenase C Antibody (NBP1-54798)

Discover related pathways, diseases and genes to Lactate Dehydrogenase C Antibody (NBP1-54798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactate Dehydrogenase C Antibody (NBP1-54798)

Discover more about diseases related to Lactate Dehydrogenase C Antibody (NBP1-54798).

Pathways for Lactate Dehydrogenase C Antibody (NBP1-54798)

View related products by pathway.

PTMs for Lactate Dehydrogenase C Antibody (NBP1-54798)

Learn more about PTMs related to Lactate Dehydrogenase C Antibody (NBP1-54798).

Research Areas for Lactate Dehydrogenase C Antibody (NBP1-54798)

Find related products by research area.

Blogs on Lactate Dehydrogenase C

There are no specific blogs for Lactate Dehydrogenase C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Lactate Dehydrogenase C Antibody and receive a gift card or discount.


Gene Symbol LDHC