Lactate Dehydrogenase C Antibody (3I8B3)

Western Blot: Lactate Dehydrogenase C Antibody (3I8B3) [NBP3-33212] - Western blot analysis of various lysates using Lactate Dehydrogenase C Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3I8B3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lactate Dehydrogenase C Antibody (3I8B3) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase C (P07864).
  
  Sequence:
  MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LDHC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lactate Dehydrogenase C Antibody (3I8B3)

• Cancer/testis antigen 32
• CT32EC 1.1.1.27
• EC 1.1.1
• lactate dehydrogenase C
• lactate dehydrogenase C4
• LDH testis subunit
• LDH3MGC111073
• LDH-C
• LDHX
• LDH-X
• L-lactate dehydrogenase C chain

Background

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa) (2). LDHA and LDHB are expressed in most somatic tissues, while expression of LDHC is confined to the germinal epithelium of the testes (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LDHC