Kv8.2 Antibody - BSA Free

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kv8.2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kv8.2 Antibody - BSA Free (NBP3-03519) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 177-261 of human Kv8.2 (NP_598004.1). CPRRFLEELGYWGVRLKYTPRCCRICFEERRDELSERLKIQHELRAQAQVEEAEELFRDMRFYGPQRRRLWNLMEKPFSSVAAKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNV2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000-1:2000
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kv8.2 Antibody - BSA Free

• KV11.1
• Kv8.2
• MGC120515
• potassium channel, subfamily V, member 2
• potassium voltage-gated channel subfamily V member 2
• RCD3B
• voltage-gated potassium channel Kv8.2
• Voltage-gated potassium channel subunit Kv8.2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamilymembers. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channelsubunits. This protein is strongly expressed in pancreas and has a weaker expression in several other tissues.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNV2