Recombinant Human Kv6.3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Kv6.3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 23 - 121 of Human KCNG3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNG3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv6.3 Protein

  • KV10.1
  • KV6.3
  • potassium voltage-gated channel subfamily G member 3
  • potassium voltage-gated channel, subfamily G, member 3
  • voltage-gated potassium channel 6.3
  • voltage-gated potassium channel Kv10.1
  • Voltage-gated potassium channel subunit Kv10.1
  • Voltage-gated potassium channel subunit Kv6.3
  • voltage-gated potassium channel subunit Kv6.4

Background

KCNG3 - potassium voltage-gated channel, subfamily G, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81605
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82860
Species: Hu
Applications: IHC, IHC-P
NBP2-17028
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBL1-12154
Species: Hu
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-14141
Species: Hu
Applications: IHC, IHC-P
NBP1-82588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00170850-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Kv6.3 Partial Recombinant Protein (H00170850-Q01) (0)

There are no publications for Kv6.3 Partial Recombinant Protein (H00170850-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv6.3 Partial Recombinant Protein (H00170850-Q01) (0)

There are no reviews for Kv6.3 Partial Recombinant Protein (H00170850-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv6.3 Partial Recombinant Protein (H00170850-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv6.3 Products

Bioinformatics Tool for Kv6.3 Partial Recombinant Protein (H00170850-Q01)

Discover related pathways, diseases and genes to Kv6.3 Partial Recombinant Protein (H00170850-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv6.3 Partial Recombinant Protein (H00170850-Q01)

Discover more about diseases related to Kv6.3 Partial Recombinant Protein (H00170850-Q01).
 

Pathways for Kv6.3 Partial Recombinant Protein (H00170850-Q01)

View related products by pathway.

PTMs for Kv6.3 Partial Recombinant Protein (H00170850-Q01)

Learn more about PTMs related to Kv6.3 Partial Recombinant Protein (H00170850-Q01).

Blogs on Kv6.3

There are no specific blogs for Kv6.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv6.3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNG3