Kv3.3 Antibody (6F7)

Images

 
Sandwich ELISA: Kv3.3 Antibody (6F7) [H00003748-M02] - Detection limit for recombinant GST tagged KCNC3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kv3.3 Antibody (6F7) Summary

Immunogen
KCNC3 (NP_004968 671 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (6F7)

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-55745
Species: Hu
Applications: ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
H00003748-M02
Species: Hu
Applications: WB, ELISA

Publications for Kv3.3 Antibody (H00003748-M02) (0)

There are no publications for Kv3.3 Antibody (H00003748-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv3.3 Antibody (H00003748-M02) (0)

There are no reviews for Kv3.3 Antibody (H00003748-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv3.3 Antibody (H00003748-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv3.3 Products

Bioinformatics Tool for Kv3.3 Antibody (H00003748-M02)

Discover related pathways, diseases and genes to Kv3.3 Antibody (H00003748-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Antibody (H00003748-M02)

Discover more about diseases related to Kv3.3 Antibody (H00003748-M02).
 

Pathways for Kv3.3 Antibody (H00003748-M02)

View related products by pathway.

PTMs for Kv3.3 Antibody (H00003748-M02)

Learn more about PTMs related to Kv3.3 Antibody (H00003748-M02).
 

Research Areas for Kv3.3 Antibody (H00003748-M02)

Find related products by research area.

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.3 Antibody (6F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNC3
Uniprot