Kv3.3 Antibody (6F7) - Azide and BSA Free

Sandwich ELISA: Kv3.3 Antibody (6F7) [H00003748-M02] - Detection limit for recombinant GST tagged KCNC3 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Kv3.3 Antibody (6F7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KCNC3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (6F7) - Azide and BSA Free

• KSHIIID
• KV3.3
• potassium voltage-gated channel subfamily C member 3
• potassium voltage-gated channel, Shaw-related subfamily, member 3
• SCA13
• Shaw-related voltage-gated potassium channel protein 3
• spinocerebellar ataxia 13
• voltage-gated potassium channel protein KV3.3
• Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNC3
• Uniprot:
  • NP_004968(Human)