Recombinant Human Ku80/XRCC5 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human Ku80/XRCC5 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-732 of Human XRCC5
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: XRCC5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 106.26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ku80/XRCC5 GST (N-Term) Protein

• 80kDa
• ATP-dependent DNA helicase 2 subunit 2
• ATP-dependent DNA helicase II 80 kDa subunit
• CTC85
• CTCBF
• EC 3.6.4.-
• FLJ39089
• G22P2
• KARP1
• KARP-1
• Ku80
• Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen
• Ku86
• Ku86DNA repair protein XRCC5
• KUB2
• NFIV
• Thyroid-lupus autoantigen
• TLAA
• X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit
• X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD)
• X-ray repair cross-complementing protein 5
• X-ray repair, complementing defective, repair in Chinese hamster
• XRCC5

Background

XRCC5( AAH19027, 1 a.a. - 733 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Ku80/XRCC5 Recombinant Protein (H00007520-P01)(2)

Publications using H00007520-P01

• Xia W, Ci S, Li M et al. Two-way crosstalk between BER and c-NHEJ repair pathway is mediated by Pol-? and Ku70. FASEB J. 2019-07-26 [PMID: 31348687]
• Oing C, Tennstedt P, Simon R et al. BCL2-overexpressing prostate cancer cells rely on PARP1-dependent end-joining and are sensitive to combined PARP inhibitor and radiation therapy. Cancer Lett 2018-06-01 [PMID: 29526801] (Human)

Bioinformatics

• Gene Symbol: XRCC5