Ku70/XRCC6 Recombinant Protein Antigen

Images

 
There are currently no images for Ku70/XRCC6 Protein (NBP2-38954PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ku70/XRCC6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC6.

Source: E.coli

Amino Acid Sequence: DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XRCC6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38954.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Ku70/XRCC6 Recombinant Protein Antigen

  • 5'-deoxyribose-5-phosphate lyase Ku70
  • 5'-dRP lyase Ku70
  • 70 kDa subunit of Ku antigen
  • ATP-dependent DNA helicase 2 subunit 1
  • ATP-dependent DNA helicase II 70 kDa subunit
  • CTC box binding factor 75 kDa subunit
  • CTC box-binding factor 75 kDa subunit
  • CTC75
  • CTCBF
  • D22S731
  • EC 3.6.4.-
  • EC 4.2.99.-
  • G22P1
  • G22P1Ku70
  • Ku autoantigen p70 subunit
  • Ku autoantigen, 70kDa
  • Ku70
  • ML8
  • ML8,70 kDa subunit
  • thyroid-lupus autoantigen p70
  • Thyroid-lupus autoantigen
  • TLAA
  • TLAAD22S671
  • X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6
  • X-ray repair cross-complementing protein 6
  • XRCC6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-183
Species: Hu
Applications: WB
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-38954PEP
Species: Hu
Applications: AC

Publications for Ku70/XRCC6 Protein (NBP2-38954PEP) (0)

There are no publications for Ku70/XRCC6 Protein (NBP2-38954PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ku70/XRCC6 Protein (NBP2-38954PEP) (0)

There are no reviews for Ku70/XRCC6 Protein (NBP2-38954PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Ku70/XRCC6 Protein (NBP2-38954PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Ku70/XRCC6 Protein (NBP2-38954PEP)

Discover related pathways, diseases and genes to Ku70/XRCC6 Protein (NBP2-38954PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ku70/XRCC6 Protein (NBP2-38954PEP)

Discover more about diseases related to Ku70/XRCC6 Protein (NBP2-38954PEP).
 

Pathways for Ku70/XRCC6 Protein (NBP2-38954PEP)

View related products by pathway.

PTMs for Ku70/XRCC6 Protein (NBP2-38954PEP)

Learn more about PTMs related to Ku70/XRCC6 Protein (NBP2-38954PEP).
 

Research Areas for Ku70/XRCC6 Protein (NBP2-38954PEP)

Find related products by research area.

Blogs on Ku70/XRCC6

There are no specific blogs for Ku70/XRCC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nbs1 Antibody
NB100-143
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ku70/XRCC6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC6
Entrez