KSR1 Antibody

Images

 
Immunohistochemistry-Paraffin: KSR1 Antibody [NBP1-82863] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KSR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPA
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KSR1 Protein (NBP1-82863PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KSR1 Antibody

  • kinase suppressor of ras 1
  • kinase suppressor of ras
  • KSRRSU2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
210-TA/CF
Species: Hu
Applications: BA
H00283455-M08
Species: Hu, Mu
Applications: ELISA, KD, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-43792
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67332
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-82863
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for KSR1 Antibody (NBP1-82863) (0)

There are no publications for KSR1 Antibody (NBP1-82863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KSR1 Antibody (NBP1-82863) (0)

There are no reviews for KSR1 Antibody (NBP1-82863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KSR1 Antibody (NBP1-82863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KSR1 Products

Array NBP1-82863

Bioinformatics Tool for KSR1 Antibody (NBP1-82863)

Discover related pathways, diseases and genes to KSR1 Antibody (NBP1-82863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KSR1 Antibody (NBP1-82863)

Discover more about diseases related to KSR1 Antibody (NBP1-82863).
 

Pathways for KSR1 Antibody (NBP1-82863)

View related products by pathway.

PTMs for KSR1 Antibody (NBP1-82863)

Learn more about PTMs related to KSR1 Antibody (NBP1-82863).
 

Research Areas for KSR1 Antibody (NBP1-82863)

Find related products by research area.

Blogs on KSR1

There are no specific blogs for KSR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KSR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KSR1