KRR1 Antibody - Azide and BSA Free

Western Blot: KRR1 Antibody [H00011103-B01P] - Analysis of HRB2 expression in human pancreas.

Western Blot: KRR1 Antibody [H00011103-B01P] - Analysis of KRR1 expression in HeLa.

Western Blot: KRR1 Antibody [H00011103-B01P] - Analysis of KRR1 expression in transfected 293T cell line by KRR1 polyclonal antibody. Lane 1: HRB2 transfected lysate(41.91 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KRR1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse KRR1 Antibody - Azide and BSA Free (H00011103-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: KRR1 (AAH26107.1, 1 a.a. - 381 a.a.) full-length human protein. MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK
• Specificity: KRR1 - KRR1, small subunit (SSU) processome component, homolog (yeast),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KRR1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KRR1 Antibody - Azide and BSA Free

• HIV-1 Rev binding protein 2
• HIV-1 Rev-binding protein 2
• HRB2
• KRR1 small subunit processome component homolog
• KRR1, small subunit (SSU) processome component, homolog (yeast)
• Rev interacting protein
• Rev-interacting protein 1
• Rip-1

Background

KRR1 is required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRR1
• Entrez:
  • 11103(Human)
• Uniprot:
  • AAH26107.1(Human)