KNTC1 Antibody (10H4)

Images

 
Western Blot: KNTC1 Antibody (10H4) [H00009735-M01] - KNTC1 monoclonal antibody (M01), clone 10H4 Analysis of KNTC1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: KNTC1 Antibody (10H4) [H00009735-M01] - Analysis of monoclonal antibody to KNTC1 on HeLa cell. Antibody concentration 50 ug/ml.
Sandwich ELISA: KNTC1 Antibody (10H4) [H00009735-M01] - Detection limit for recombinant GST tagged KNTC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
10H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KNTC1 Antibody (10H4) Summary

Immunogen
KNTC1 (NP_055523, 2100 a.a. ~ 2210 a.a) partial recombinant protein with GST tag.DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGIL AKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEY SKHCGKPVPPDTAPCEILKMFLSGLS
Specificity
KNTC1 - kinetochore associated 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KNTC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publications using H00009735-M01.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KNTC1 Antibody (10H4)

  • FLJ36151
  • hRod
  • hsROD
  • KIAA0166Rough Deal homolog, centromere/kinetochore protein
  • kinetochore associated 1
  • kinetochore-associated protein 1
  • Rod
  • RODHsROD
  • Rough deal homolog

Background

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-21057
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KNTC1 Antibody (H00009735-M01)(2)

Reviews for KNTC1 Antibody (H00009735-M01) (0)

There are no reviews for KNTC1 Antibody (H00009735-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KNTC1 Antibody (H00009735-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KNTC1 Products

Bioinformatics Tool for KNTC1 Antibody (H00009735-M01)

Discover related pathways, diseases and genes to KNTC1 Antibody (H00009735-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KNTC1 Antibody (H00009735-M01)

Discover more about diseases related to KNTC1 Antibody (H00009735-M01).
 

Pathways for KNTC1 Antibody (H00009735-M01)

View related products by pathway.

Research Areas for KNTC1 Antibody (H00009735-M01)

Find related products by research area.

Blogs on KNTC1

There are no specific blogs for KNTC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KNTC1 Antibody (10H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol KNTC1
Entrez
OMIM
Uniprot