KNTC1 Antibody (10D9)

Images

 
Western Blot: KNTC1 Antibody (10D9) [H00009735-M02] - Detection against Immunogen (37.84 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
10D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

KNTC1 Antibody (10D9) Summary

Immunogen
KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KNTC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KNTC1 Antibody (10D9)

  • FLJ36151
  • hRod
  • hsROD
  • KIAA0166Rough Deal homolog, centromere/kinetochore protein
  • kinetochore associated 1
  • kinetochore-associated protein 1
  • Rod
  • RODHsROD
  • Rough deal homolog

Background

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KNTC1 Antibody (H00009735-M02) (0)

There are no publications for KNTC1 Antibody (H00009735-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KNTC1 Antibody (H00009735-M02) (0)

There are no reviews for KNTC1 Antibody (H00009735-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KNTC1 Antibody (H00009735-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KNTC1 Products

Array H00009735-M02

Research Areas for KNTC1 Antibody (H00009735-M02)

Find related products by research area.

Blogs on KNTC1

There are no specific blogs for KNTC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KNTC1 Antibody (10D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol KNTC1
Uniprot