KMT2A/MLL Recombinant Protein Antigen

Images

 
There are currently no images for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KMT2A/MLL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KMT2A/MLL.

Source: E. coli

Amino Acid Sequence: DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KMT2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55237.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KMT2A/MLL Recombinant Protein Antigen

  • ALL1
  • ALL-1MLL/GAS7
  • CXXC7TET1-MLL
  • CXXC-type zinc finger protein 7
  • EC 2.1.1.43
  • HRXFLJ11783
  • HTRX
  • HTRX1MLL-AF4 der(11) fusion protein
  • KMT2ACDK6/MLL fusion protein
  • Lysine N-methyltransferase 2A
  • MLL/GAS7 fusion protein
  • MLL/GMPS fusion protein
  • MLL1
  • MLL1A
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog)
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
  • Trithorax-like protein
  • TRX1histone-lysine N-methyltransferase MLL
  • Zinc finger protein HRX

Background

The MLL gene encodes a DNA-binding protein that methylates histone H3 (see MIM 601128) lys4 (H3K4) and positively regulates expression of target genes, including multiple HOX genes (see MIM 142980). MLL is a frequent target for recurrent translocations in acute leukemias that may be characterized as acute myeloid leukemia (AML; MIM 601626), acute lymphoblastic leukemia (ALL), or mixed lineage (biphenotypic) leukemia (MLL). Leukemias with translocations involving MLL possess unique clinical and biologic characteristics and are often associated with poor prognosis. MLL rearrangements are found in more than 70% of infant leukemias, whether the immunophenotype is more consistent with ALL or AML6, but are less frequent in leukemias from older children. MLL translocations are also found in approximately 10% of AMLs in adults, as well as in therapy-related leukemias, most often characterized as AML, that develop in patients previously treated with topoisomerase II inhibitors for other malignancies. More than 50 different MLL fusion partners have been identified. Leukemogenic MLL translocations encode MLL fusion proteins that have lost H3K4 methyltransferase activity. A key feature of MLL fusion proteins is their ability to efficiently transform hematopoietic cells into leukemia stem cells (Krivtsov and Armstrong, 2007 (PubMed 17957188)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-28728
Species: Hu
Applications: IHC,  IHC-P, IP (-), WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3254
Species: Hu, Mu, Rt
Applications: WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-15303
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP1-90222
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-80695
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-45606
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-215
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, Simple Western, WB

Publications for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP) (0)

There are no publications for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP) (0)

There are no reviews for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KMT2A/MLL Products

Research Areas for KMT2A/MLL Recombinant Protein Antigen (NBP2-55237PEP)

Find related products by research area.

Blogs on KMT2A/MLL

There are no specific blogs for KMT2A/MLL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KMT2A/MLL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KMT2A