Recombinant Human KLF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KLF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 20455 of Human KLF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF2 Protein

  • KLF2
  • Krueppel-like factor 2
  • Kruppel-like factor 2 (lung)
  • Kruppel-like factor LKLF
  • LKLF
  • LKLFLung krueppel-like factor
  • lung Kruppel-like zinc finger transcription factor

Background

KLF2 - Kruppel-like factor 2 (lung)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3158
Species: Mu
Applications: WB, ChIP, ICC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00010365-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no publications for KLF2 Partial Recombinant Protein (H00010365-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no reviews for KLF2 Partial Recombinant Protein (H00010365-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF2 Products

Bioinformatics Tool for KLF2 Partial Recombinant Protein (H00010365-Q01)

Discover related pathways, diseases and genes to KLF2 Partial Recombinant Protein (H00010365-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF2 Partial Recombinant Protein (H00010365-Q01)

Discover more about diseases related to KLF2 Partial Recombinant Protein (H00010365-Q01).
 

Pathways for KLF2 Partial Recombinant Protein (H00010365-Q01)

View related products by pathway.

PTMs for KLF2 Partial Recombinant Protein (H00010365-Q01)

Learn more about PTMs related to KLF2 Partial Recombinant Protein (H00010365-Q01).

Blogs on KLF2.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Nucleolin Antibodies: Knowing When it's Time to Split
Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ...  Read full blog post.

Customers Who Bought This Also Bought

KLF2 Partial Protein
H00010365-Q03-10ug
KLF2 Antibody
NB100-1051
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF2
Entrez