Recombinant Human KLF2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human KLF2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-56 of Human KLF2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
31.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KLF2 GST (N-Term) Protein

  • KLF2
  • Krueppel-like factor 2
  • Kruppel-like factor 2 (lung)
  • Kruppel-like factor LKLF
  • LKLF
  • LKLFLung krueppel-like factor
  • lung Kruppel-like zinc finger transcription factor

Background

KLF2 - Kruppel-like factor 2 (lung)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
210-TA
Species: Hu
Applications: BA
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF2848
Species: Hu, Mu
Applications: ICC, WB
728-LS
Species: Hu
Applications: BA
DTHBD0
Species: Hu
Applications: ELISA
AF3758
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-67763
Species: Hu
Applications: ICC/IF, WB
H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
QET00B
Species: Hu
Applications: ELISA
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Publications for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no publications for KLF2 Partial Recombinant Protein (H00010365-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no reviews for KLF2 Partial Recombinant Protein (H00010365-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLF2 Partial Recombinant Protein (H00010365-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF2 Products

Bioinformatics Tool for KLF2 Partial Recombinant Protein (H00010365-Q01)

Discover related pathways, diseases and genes to KLF2 Partial Recombinant Protein (H00010365-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLF2 Partial Recombinant Protein (H00010365-Q01)

Discover more about diseases related to KLF2 Partial Recombinant Protein (H00010365-Q01).
 

Pathways for KLF2 Partial Recombinant Protein (H00010365-Q01)

View related products by pathway.

PTMs for KLF2 Partial Recombinant Protein (H00010365-Q01)

Learn more about PTMs related to KLF2 Partial Recombinant Protein (H00010365-Q01).

Blogs on KLF2.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Nucleolin Antibodies: Knowing When it's Time to Split
Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KLF2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF2