| Immunogen | KLF2 (NP_057354, 1 a.a. - 56 a.a.) partial recombinant protein with GST tag. MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL |
| Specificity | KLF2 - Kruppel-like factor 2 (lung) |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | KLF2 |
| Purity | Unpurified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | 50% Glycerol |
| Preservative | No Preservative |
| Purity | Unpurified |
Secondary Antibodies |
Isotype Controls |
|
KLF4 as a transcription factor in stem cell differentiation Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel... Read full blog post. |
|
Nucleolin Antibodies: Knowing When it's Time to Split Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.