KLF13 Antibody - Azide and BSA Free

Western Blot: KLF13 Antibody [NBP3-15528] - Western blot analysis of extracts of various cell lines, using KLF13 antibody (NBP3-15528) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KLF13 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit KLF13 Antibody - Azide and BSA Free (NBP3-15528) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2). PPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLF13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for KLF13 Antibody - Azide and BSA Free

• basic transcription element binding protein 3
• Basic transcription element-binding protein 3
• BTEB3FKLF2
• BTE-binding protein 3
• Krueppel-like factor 13
• Kruppel-like factor 13
• Novel Sp1-like zinc finger transcription factor 1
• NSLP1RFLAT1
• RANTES factor of late activated T lymphocytes-1
• RANTES factor of late activated T-lymphocytes 1
• RFLAT-1FKLF-2
• Sp1 like zinc finger transcription factor
• Transcription factor BTEB3
• Transcription factor NSLP1

Background

RANTES factor of Late Activated T Lymphocytes-1 (RFLAT-1) is a novel protein belonging to the TFIIIA-like zinc finger protein superfamily and binds to the A site of RANTES (Regulated upon Activation, Normal T cell Expressed and Secreted) chemokine. RANTES is involved in the generation of inflammatory infiltrate and HIV entry into immune cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KLF13