KLF13 Antibody - Azide and BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2). PPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLF13 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for KLF13 Antibody - Azide and BSA Free
Background
RANTES factor of Late Activated T Lymphocytes-1 (RFLAT-1) is a novel protein belonging to the TFIIIA-like zinc finger protein superfamily and binds to the A site of RANTES (Regulated upon Activation, Normal T cell Expressed and Secreted) chemokine. RANTES is involved in the generation of inflammatory infiltrate and HIV entry into immune cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for KLF13 Antibody (NBP3-15528) (0)
There are no publications for KLF13 Antibody (NBP3-15528).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KLF13 Antibody (NBP3-15528) (0)
There are no reviews for KLF13 Antibody (NBP3-15528).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KLF13 Antibody (NBP3-15528) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KLF13 Products
Research Areas for KLF13 Antibody (NBP3-15528)
Find related products by research area.
|
Blogs on KLF13