We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

KLF12 Recombinant Protein Antigen

Images

 
There are currently no images for KLF12 Recombinant Protein Antigen (NBP2-56075PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KLF12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLF12.

Source: E. coli

Amino Acid Sequence: IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLF12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56075.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KLF12 Recombinant Protein Antigen

  • AP-2rep transcription factor
  • AP2REP
  • AP-2rep
  • AP2REPAP-2 repressor
  • HSPC122
  • KLF12 zinc finger transcriptional repressor
  • KLF12
  • Krueppel-like factor 12
  • Kruppel-like factor 12
  • Transcriptional repressor AP-2rep

Background

KLF12 is a gene the codes for a protein that bonds to A32 in the AP-2-alpha gene promoter in order to facilitate the transcriptional repression to the AP-2-alpha gene. KLF12 has two isoforms, with lengths of 402 and 269 amino acids, and weights of approximately 44 and 28 kDa respectively. Current studies are being done on diseases and disorders relating to this gene, including Wegener's granulomatosis, rheumatoid arthritis, gastric cancer, pancreatic cancer, pancreatitis, and schizophrenia. KLF12 has also been shown to have interactions with EHMT2, CTBP1, and SIRT2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
AF3758
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
MAB5466
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-48937
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008462-M03
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45511
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-57740
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P
H00051621-M01
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-87909
Species: Hu
Applications: IHC,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
AF2818
Species: Hu
Applications: ICC, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-56075PEP
Species: Hu
Applications: AC

Publications for KLF12 Recombinant Protein Antigen (NBP2-56075PEP) (0)

There are no publications for KLF12 Recombinant Protein Antigen (NBP2-56075PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLF12 Recombinant Protein Antigen (NBP2-56075PEP) (0)

There are no reviews for KLF12 Recombinant Protein Antigen (NBP2-56075PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KLF12 Recombinant Protein Antigen (NBP2-56075PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KLF12 Products

Research Areas for KLF12 Recombinant Protein Antigen (NBP2-56075PEP)

Find related products by research area.

Blogs on KLF12

There are no specific blogs for KLF12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KLF12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLF12