Kir6.1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human testis shows very weak cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human heart muscle shows weak to moderate cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kir6.1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kir6.1 Antibody - BSA Free (NBP1-87710) is a polyclonal antibody validated for use in IHC and WB. Anti-Kir6.1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 -1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Reactivity reported in (PMID: 36282858).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kir6.1 Protein (NBP1-87710PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30995106).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kir6.1 Antibody - BSA Free

• ATP-sensitive inward rectifier potassium channel 8
• Inward rectifier K(+) channel Kir6.1
• inwardly rectifying potassium channel KIR6.1
• KCNJ8
• Kir6.1
• Potassium channel, inwardly rectifying subfamily J member 8
• potassium inwardly-rectifying channel, subfamily J, member 8
• uKATP-1

Background

The Kir6.1 (KCNJ8) gene is essential in membrane function as it encodes an inward-rectifier potassium channel protein that is 424 amino acids long and has a mass of nearly 48 kDA. Dysfunctions in the Kir6.1 gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). Research is investigating its role in various diseases such as retinitis, hypoxia, pancreatitis, myocardial infarction, spasticity, leiomyoma, acute myocardial infarction, and prinzmetal angina. The Kir6.1 gene plays a significant role in ATP sensitive potassium channels, SIDS susceptibility pathways, dopamine feedback into cAMP pathway, and the CFTR-dependent regulation of ion channels in airway epithelium. It interacts with other genes such as KCNJ2, ABCC8, ABCC9, and KCNJ11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Kir6.1 Antibody (NBP1-87710)(2)

Publications using NBP1-87710

• Pham DL, Niemi A, Ko ML, Ko GYP Peptide Lv augments intermediate-conductance calcium-dependent potassium channels (KCa3.1) in endothelial cells to promote angiogenesis PloS one 2022-10-25 [PMID: 36282858] (WB, Human)
• Wang, Y;Hall, LM;Kujawa, M;Li, H;Zhang, X;O'Meara, M;Ichinose, T;Wang, JM; Methylglyoxal Triggers Human Aortic Endothelial Cell Dysfunction via Modulating KATP/MAPK pathway Am. J. Physiol., Cell Physiol. 2019-04-17 [PMID: 30995106] (WB, Mouse)

Bioinformatics

• Gene Symbol: KCNJ8