Kir6.1 Antibody

Images

 
Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human testis shows very weak cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Kir6.1 Antibody [NBP1-87710] - Staining of human heart muscle shows weak to moderate cytoplasmic positivity in cardiomyocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kir6.1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Reactivity reported in (PMID: 36282858).
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kir6.1 Protein (NBP1-87710PEP)
Publications
Read Publications using
NBP1-87710 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30995106).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kir6.1 Antibody

  • ATP-sensitive inward rectifier potassium channel 8
  • Inward rectifier K(+) channel Kir6.1
  • inwardly rectifying potassium channel KIR6.1
  • KCNJ8
  • Kir6.1
  • Potassium channel, inwardly rectifying subfamily J member 8
  • potassium inwardly-rectifying channel, subfamily J, member 8
  • uKATP-1

Background

The Kir6.1 (KCNJ8) gene is essential in membrane function as it encodes an inward-rectifier potassium channel protein that is 424 amino acids long and has a mass of nearly 48 kDA. Dysfunctions in the Kir6.1 gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). Research is investigating its role in various diseases such as retinitis, hypoxia, pancreatitis, myocardial infarction, spasticity, leiomyoma, acute myocardial infarction, and prinzmetal angina. The Kir6.1 gene plays a significant role in ATP sensitive potassium channels, SIDS susceptibility pathways, dopamine feedback into cAMP pathway, and the CFTR-dependent regulation of ion channels in airway epithelium. It interacts with other genes such as KCNJ2, ABCC8, ABCC9, and KCNJ11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Kir6.1 Antibody (NBP1-87710)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Kir6.1 Antibody (NBP1-87710) (0)

There are no reviews for Kir6.1 Antibody (NBP1-87710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kir6.1 Antibody (NBP1-87710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kir6.1 Products

Research Areas for Kir6.1 Antibody (NBP1-87710)

Find related products by research area.

Blogs on Kir6.1

There are no specific blogs for Kir6.1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kir6.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ8