KIR3DL2/CD158k Antibody

Images

 
Western Blot: KIR3DL2/CD158k Antibody [NBP3-09425] - Western blot analysis of KIR3DL2/CD158k in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIR3DL2/CD158k Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR3DL2/CD158k (NP_006728). Peptide sequence LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
Clonality
Polyclonal
Host
Rabbit
Gene
KIR3DL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for KIR3DL2/CD158k Antibody

  • killer cell immunoglobulin-like receptor 3DL2
  • CD158k
  • CL-5
  • killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2
  • KIR3DL2
  • NKAT4
  • NKAT-4
  • NKAT4A
  • NKAT4B
  • p140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
3015-KR
Species: Hu
Applications: BA
MAB1844
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1056
Species: Rt
Applications: IHC, WB
MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
7268-CT
Species: Hu
Applications: BA
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
MAB24251
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB8919
Species: Hu
Applications: Flow
NBP3-09425
Species: Hu
Applications: WB

Publications for KIR3DL2/CD158k Antibody (NBP3-09425) (0)

There are no publications for KIR3DL2/CD158k Antibody (NBP3-09425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIR3DL2/CD158k Antibody (NBP3-09425) (0)

There are no reviews for KIR3DL2/CD158k Antibody (NBP3-09425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIR3DL2/CD158k Antibody (NBP3-09425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIR3DL2/CD158k Products

Bioinformatics Tool for KIR3DL2/CD158k Antibody (NBP3-09425)

Discover related pathways, diseases and genes to KIR3DL2/CD158k Antibody (NBP3-09425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIR3DL2/CD158k Antibody (NBP3-09425)

Discover more about diseases related to KIR3DL2/CD158k Antibody (NBP3-09425).
 

Pathways for KIR3DL2/CD158k Antibody (NBP3-09425)

View related products by pathway.

PTMs for KIR3DL2/CD158k Antibody (NBP3-09425)

Learn more about PTMs related to KIR3DL2/CD158k Antibody (NBP3-09425).

Blogs on KIR3DL2/CD158k

There are no specific blogs for KIR3DL2/CD158k, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIR3DL2/CD158k Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIR3DL2