Kir3.3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Kir3.3 Antibody - BSA Free (NBP2-83111) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Kir3.3. Peptide sequence: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNJ9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Kir3.3 Antibody - BSA Free
Background
The Kir3.3 (KCNJ9) encodes for a 393 amino acid long, 44 kDA, G-protein activated inward rectifier potassium channel protein that creates heteromultimeric pore-forming complexes. The Kir3.3 gene has been investigated in generalized epilepsy, meniere's disease, pertussis, lung cancer, schizophrenia, and diabetes mellitus. It interacts with the DRD4, KCNJ6, ADRB2, KCNJ3, and DRD2 genes in potassium transporting pathways (inward and outward), G-Beta gamma signaling, neurotransmitter receptor binding and downward transmission in the postsynaptic cell, and ion currents in synaptic transmission.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Kir3.3 Antibody (NBP2-83111) (0)
There are no publications for Kir3.3 Antibody (NBP2-83111).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kir3.3 Antibody (NBP2-83111) (0)
There are no reviews for Kir3.3 Antibody (NBP2-83111).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kir3.3 Antibody (NBP2-83111) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kir3.3 Products
Research Areas for Kir3.3 Antibody (NBP2-83111)
Find related products by research area.
|
Blogs on Kir3.3