Kir3.1 Antibody

Images

 
Immunohistochemistry: Kir3.1 Antibody [NBP1-89770] - Staining of human cerebellum shows strong cytoplasmic positivity in granular layer cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kir3.1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kir3.1 Protein (NBP1-89770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kir3.1 Antibody

  • G protein-activated inward rectifier potassium channel 1
  • GIRK-1
  • GIRK1Kir3.1
  • Inward rectifier K(+) channel Kir3.1
  • inward rectifier K+ channel KIR3.1
  • KGA
  • KIR3.1
  • Potassium channel, inwardly rectifying subfamily J member 3
  • potassium inwardly-rectifying channel, subfamily J, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88081
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74575
Species: Hu
Applications: WB, PEP-ELISA
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57515
Species: Hu
Applications: IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009541-M01
Species: Hu
Applications: WB, ELISA
NB120-2805
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12902
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Kir3.1 Antibody (NBP1-89770) (0)

There are no publications for Kir3.1 Antibody (NBP1-89770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir3.1 Antibody (NBP1-89770) (0)

There are no reviews for Kir3.1 Antibody (NBP1-89770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kir3.1 Antibody (NBP1-89770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kir3.1 Products

Bioinformatics Tool for Kir3.1 Antibody (NBP1-89770)

Discover related pathways, diseases and genes to Kir3.1 Antibody (NBP1-89770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kir3.1 Antibody (NBP1-89770)

Discover more about diseases related to Kir3.1 Antibody (NBP1-89770).
 

Pathways for Kir3.1 Antibody (NBP1-89770)

View related products by pathway.

PTMs for Kir3.1 Antibody (NBP1-89770)

Learn more about PTMs related to Kir3.1 Antibody (NBP1-89770).

Blogs on Kir3.1

There are no specific blogs for Kir3.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kir3.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ3