Kir2.2 Antibody


Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP1-89696] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal processes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Kir2.2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Specificity of human Kir2.2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kir2.2 Protein (NBP1-89696PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kir2.2 Antibody

  • ATP-sensitive inward rectifier potassium channel 12
  • hIRK
  • hIRK1
  • hkir2.2x
  • Inward rectifier K(+) channel Kir2.2
  • Inward rectifier K(+) channel Kir2.2v
  • inward rectifier K(+) channel Kir2.6
  • IRK2IRK-2
  • kcnj12x
  • KCNJN1FLJ14167
  • Kir2.2
  • Kir2.2v
  • Potassium channel, inwardly rectifying subfamily J member 12
  • potassium inwardly-rectifying channel, subfamily J, inhibitor 1
  • potassium inwardly-rectifying channel, subfamily J, member 12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kir2.2 Antibody (NBP1-89696) (0)

There are no publications for Kir2.2 Antibody (NBP1-89696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.2 Antibody (NBP1-89696) (0)

There are no reviews for Kir2.2 Antibody (NBP1-89696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kir2.2 Antibody (NBP1-89696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kir2.2 Products

Bioinformatics Tool for Kir2.2 Antibody (NBP1-89696)

Discover related pathways, diseases and genes to Kir2.2 Antibody (NBP1-89696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kir2.2 Antibody (NBP1-89696)

Discover more about diseases related to Kir2.2 Antibody (NBP1-89696).

Pathways for Kir2.2 Antibody (NBP1-89696)

View related products by pathway.

PTMs for Kir2.2 Antibody (NBP1-89696)

Learn more about PTMs related to Kir2.2 Antibody (NBP1-89696).

Blogs on Kir2.2

There are no specific blogs for Kir2.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kir2.2 Antibody and receive a gift card or discount.


Gene Symbol KCNJ12