Kinesin 5A Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT |
| Predicted Species |
Mouse (98%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KIF5A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Kinesin 5A Antibody - BSA Free
Background
Kinesin 5A is part of a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types and is subject to spatial and temporal regulation. These proteins have a modular structure including a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. There are currently three known Kinesin 5 family members denoted as A, B, and C. Kinesin 5A and kinesin 5C appear to be exclusively neuronal, whereas kinesin 5B appears to be ubiquitous in its expression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, WB
Publications for Kinesin 5A Antibody (NBP2-57903) (0)
There are no publications for Kinesin 5A Antibody (NBP2-57903).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kinesin 5A Antibody (NBP2-57903) (0)
There are no reviews for Kinesin 5A Antibody (NBP2-57903).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kinesin 5A Antibody (NBP2-57903) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kinesin 5A Products
Research Areas for Kinesin 5A Antibody (NBP2-57903)
Find related products by research area.
|
Blogs on Kinesin 5A