Kif2a Antibody

Images

 
Western Blot: Kif2a Antibody [NBP1-83253] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Kif2a Antibody [NBP1-83253] - Staining of human testis shows nuclear positivity in cells of seminiferus ducts.
Western Blot: Kif2a Antibody [NBP1-83253] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kif2a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kif2a Protein (NBP1-83253PEP)
Publications
Read Publications using NBP1-83253.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kif2a Antibody

  • HK2
  • KIF2kinesin-2
  • kinesin heavy chain member 2
  • kinesin heavy chain member 2A
  • Kinesin, heavy chain, 2
  • Kinesin-2
  • kinesin-like protein KIF2A
  • KNS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
MAB2337
Species: Hu
Applications: WB, IP
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2008
Species: Hu
Applications: WB, IHC, IP
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-83253
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for Kif2a Antibody (NBP1-83253)(2)

Reviews for Kif2a Antibody (NBP1-83253) (0)

There are no reviews for Kif2a Antibody (NBP1-83253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kif2a Antibody (NBP1-83253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kif2a Products

Bioinformatics Tool for Kif2a Antibody (NBP1-83253)

Discover related pathways, diseases and genes to Kif2a Antibody (NBP1-83253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kif2a Antibody (NBP1-83253)

Discover more about diseases related to Kif2a Antibody (NBP1-83253).
 

Pathways for Kif2a Antibody (NBP1-83253)

View related products by pathway.

PTMs for Kif2a Antibody (NBP1-83253)

Learn more about PTMs related to Kif2a Antibody (NBP1-83253).
 

Research Areas for Kif2a Antibody (NBP1-83253)

Find related products by research area.

Blogs on Kif2a.

Kif2a and MT-Destabilization during Mitosis
Kif2a belongs to the Kinesin-13 microtubule depolymerase family that includes members Kif2a, Kif2b, and Kif2c. These proteins are capable of depolymerizing microtubules (MTs) at their ends. During mitotic cell division, Kif2a specifically localizes to...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kif2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF2A