KIF22 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KIF22 Antibody [NBP2-57459] - Staining of human cell line MCF7 shows localization to nuclear speckles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF22 Antibody - BSA Free (NBP2-57459) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KIF22 Recombinant Protein Antigen (NBP2-57459PEP)

Reactivity Notes

Mouse 83%, Rat 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF22 Antibody - BSA Free

• Kid
• KIDA-328A3.2
• kinesin family member 22
• kinesin-like 4
• Kinesin-like DNA-binding protein
• Kinesin-like protein 4
• kinesin-like protein KIF22
• KNSL4kinesin-like DNA-binding protein pseudogene
• OBP
• OBP-1
• OBP-2
• origin of plasmid DNA replication-binding protein
• oriP binding protein

Background

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF22