KIF22 Antibody - BSA Free

Western Blot: KIF22 Antibody [NBP1-82876] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: KIF22 Antibody [NBP1-82876] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

• Reactivity: Hu, Mu
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF22 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF22 Antibody - BSA Free (NBP1-82876) is a polyclonal antibody validated for use in IHC and WB. Anti-KIF22 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTNESLQPHALGPVKLSQKELLGPPEAKRARG
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KIF22 Protein (NBP1-82876PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF22 Antibody - BSA Free

• Kid
• KIDA-328A3.2
• kinesin family member 22
• kinesin-like 4
• Kinesin-like DNA-binding protein
• Kinesin-like protein 4
• kinesin-like protein KIF22
• KNSL4kinesin-like DNA-binding protein pseudogene
• OBP
• OBP-1
• OBP-2
• origin of plasmid DNA replication-binding protein
• oriP binding protein

Background

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF22 Antibody (NBP1-82876)(1)

Publication using NBP1-82876

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

FAQs for KIF22 Antibody (NBP1-82876). (Showing 1 - 1 of 1 FAQ).

1. Our lab is planning to purchase the product KIF22 Antibody (NBP1-82876) from your company and I'm wondering if the protocol you provide online (ICC protocol) is what you used for that antibody? Is there any specific attention we should pay in order to use this protocol for immunofluorescence with KIF22 Antibody (NBP1-82876)? Thanks a lot!
   • Our lab did not use any customized protocol for the validation of this antibody and the only special recommendation would be about fixation using PFA and permeabilization by Triton X-100. This antibody should work for ICC-IF at a working concentration of 1-4 ug/ml. Please see our commonly used ICC-IF protocol. Novus Biologicals stand by the quality of its products and all of our products are 100% guaranteed. We are always there to help in case you face any trouble in generating your desired outcome out of the use of our products.

Bioinformatics

• Gene Symbol: KIF22