KIF1C Antibody


Immunohistochemistry-Paraffin: KIF1C Antibody [NBP2-48824] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry: KIF1C Antibody [NBP2-48824] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

KIF1C Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QAHICKLMGILQQVKLQNSSKDWELQALQDRMVCMERIIPLAQDHEDENEEGGEFHWA
Specificity of human KIF1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
KIF1C Lysate (NBP2-65837)
Control Peptide
KIF1C Recombinant Protein Antigen (NBP2-48824PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KIF1C Antibody

  • KIAA0706
  • kinesin family member 1C
  • kinesin-like protein KIF1C
  • LTXS1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIF1C Antibody (NBP2-48824) (0)

There are no publications for KIF1C Antibody (NBP2-48824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF1C Antibody (NBP2-48824) (0)

There are no reviews for KIF1C Antibody (NBP2-48824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF1C Antibody (NBP2-48824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for KIF1C Antibody (NBP2-48824)

Discover related pathways, diseases and genes to KIF1C Antibody (NBP2-48824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF1C Antibody (NBP2-48824)

Discover more about diseases related to KIF1C Antibody (NBP2-48824).

Pathways for KIF1C Antibody (NBP2-48824)

View related products by pathway.

PTMs for KIF1C Antibody (NBP2-48824)

Learn more about PTMs related to KIF1C Antibody (NBP2-48824).

Research Areas for KIF1C Antibody (NBP2-48824)

Find related products by research area.

Blogs on KIF1C

There are no specific blogs for KIF1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KIF1C Antibody and receive a gift card or discount.


Gene Symbol KIF1C