KIF21B Antibody

Images

 
Immunohistochemistry-Paraffin: KIF21B Antibody [NBP1-84187] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF21B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TMKGSTSHDDFKFKSEPKLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF21B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF21B Protein (NBP1-84187PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF21B Antibody

  • FLJ16314
  • KIAA0449
  • kinesin family member 21B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-85978
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
H00055254-P01
Species: Hu
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-56242
Species: Hu
Applications: ICC/IF
H00009056-B01P
Species: Hu, Rt
Applications: WB
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88976
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-17055
Species: Hu
Applications: WB, IHC, IHC-P
MAB8245
Species: Hu
Applications: IHC
NBP1-84187
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for KIF21B Antibody (NBP1-84187) (0)

There are no publications for KIF21B Antibody (NBP1-84187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF21B Antibody (NBP1-84187) (0)

There are no reviews for KIF21B Antibody (NBP1-84187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF21B Antibody (NBP1-84187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF21B Products

Bioinformatics Tool for KIF21B Antibody (NBP1-84187)

Discover related pathways, diseases and genes to KIF21B Antibody (NBP1-84187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF21B Antibody (NBP1-84187)

Discover more about diseases related to KIF21B Antibody (NBP1-84187).
 

Pathways for KIF21B Antibody (NBP1-84187)

View related products by pathway.

Blogs on KIF21B

There are no specific blogs for KIF21B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF21B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF21B