We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

KIF18A Recombinant Protein Antigen

Images

 
There are currently no images for KIF18A Protein (NBP1-85127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KIF18A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF18A.

Source: E. coli

Amino Acid Sequence: AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF18A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIF18A Recombinant Protein Antigen

  • DKFZP434G2226
  • KIF18A
  • kinesin family member 18A
  • kinesin-like protein KIF18A
  • Marrow stromal KIF18A
  • MS-KIF18A
  • OK/SW-cl.108

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, chromosome congression, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF18 has been demonstrated to be a microtubule depolymerase essential for chromosome alignment at the spindle equator. Alternate names for KIF18A include kinesin family member 18A, kinesin-like protein KIF18A, and DKFZP434G2226.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83936
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-87976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74638
Species: Hu
Applications: ICC/IF, IP, WB (-)
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NBP1-84880
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7707-NP
Species: Hu
Applications: BA
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
MAB4165
Species: Hu
Applications: IHC, WB
NBP2-37550
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP1-86710
Species: Hu
Applications: WB
NBP1-83721
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85127PEP
Species: Hu
Applications: AC

Publications for KIF18A Protein (NBP1-85127PEP) (0)

There are no publications for KIF18A Protein (NBP1-85127PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF18A Protein (NBP1-85127PEP) (0)

There are no reviews for KIF18A Protein (NBP1-85127PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF18A Protein (NBP1-85127PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF18A Products

Research Areas for KIF18A Protein (NBP1-85127PEP)

Find related products by research area.

Blogs on KIF18A

There are no specific blogs for KIF18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF18A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF18A