KIF14 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KIF14 Antibody [NBP2-55378] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KIF14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIF14 Antibody - BSA Free (NBP2-55378) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLSMMIQEANAISSKLKTYYVFGRHDISDKSSSDTSIRVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KIF14 Recombinant Protein Antigen (NBP2-55378PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIF14 Antibody - BSA Free

• KIAA0042MGC142302
• kinesin family member 14
• kinesin-like protein KIF14

Background

The kinesin superfamily proteins (KIFs) are microtubule-dependent molecular motors that transport membranous organelles and protein complexes in a microtubule and ATP-dependent manner. Cells use KIFs to tightly control the direction, destination and speed of the transportation of a variety of important functional molecules, including mRNA. KIFs are involved in neuronal function and development. Kinesin family member 14 (KIF14) is an overexpressed potential oncogene in the 1q region of genomic gain in breast cancer cell lines associated with poor prognosis breast cancer. The gain of chromosome 1q likely reflects oncogene amplification. As such KIF14 may be a potential therapeutic target and indicator of oncogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIF14