KIF14 Antibody

Images

 
Immunohistochemistry-Paraffin: KIF14 Antibody [NBP1-83055] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIF14 Protein (NBP1-83055PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF14 Antibody

  • KIAA0042MGC142302
  • kinesin family member 14
  • kinesin-like protein KIF14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80295
Species: Hu
Applications: WB
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
MAB7020
Species: Hu
Applications: WB, IHC
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-40844
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
NBP1-83720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87947
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KIF14 Antibody (NBP1-83055) (0)

There are no publications for KIF14 Antibody (NBP1-83055).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF14 Antibody (NBP1-83055) (0)

There are no reviews for KIF14 Antibody (NBP1-83055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIF14 Antibody (NBP1-83055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF14 Products

Bioinformatics Tool for KIF14 Antibody (NBP1-83055)

Discover related pathways, diseases and genes to KIF14 Antibody (NBP1-83055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF14 Antibody (NBP1-83055)

Discover more about diseases related to KIF14 Antibody (NBP1-83055).
 

Pathways for KIF14 Antibody (NBP1-83055)

View related products by pathway.

PTMs for KIF14 Antibody (NBP1-83055)

Learn more about PTMs related to KIF14 Antibody (NBP1-83055).
 

Research Areas for KIF14 Antibody (NBP1-83055)

Find related products by research area.

Blogs on KIF14

There are no specific blogs for KIF14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF14