KIF13A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIF13A Antibody [NBP1-88758] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: KIF13A Antibody [NBP1-88758] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIF13A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITSGYFSHSASNATLSDMVVPSSDSSDQLAIQTKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIVVPLKENSALAKGSPSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF13A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIF13A Protein (NBP1-88758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIF13A Antibody

  • bA500C11.2
  • FLJ27232
  • homolog of mouse KIF13A mannose-6-phosphate receptor transporter
  • kinesin family member 13A
  • kinesin-like protein KIF13A
  • Kinesin-like protein RBKIN
  • RBKIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88911
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
26520002
Species: Hu
Applications: WB, ELISA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33649
Species: Hu
Applications: WB, IHC, IHC-P
AF5320
Species: Hu
Applications: WB
NB100-56628
Species: Hu
Applications: WB
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for KIF13A Antibody (NBP1-88758) (0)

There are no publications for KIF13A Antibody (NBP1-88758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF13A Antibody (NBP1-88758) (0)

There are no reviews for KIF13A Antibody (NBP1-88758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIF13A Antibody (NBP1-88758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF13A Products

Bioinformatics Tool for KIF13A Antibody (NBP1-88758)

Discover related pathways, diseases and genes to KIF13A Antibody (NBP1-88758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIF13A Antibody (NBP1-88758)

Discover more about diseases related to KIF13A Antibody (NBP1-88758).
 

Pathways for KIF13A Antibody (NBP1-88758)

View related products by pathway.

PTMs for KIF13A Antibody (NBP1-88758)

Learn more about PTMs related to KIF13A Antibody (NBP1-88758).

Blogs on KIF13A

There are no specific blogs for KIF13A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF13A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF13A