KIAA1109/FSA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human kidney shows very weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA1109/FSA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VASVKEWFNYVTATRNEELNLLRNVDANNTENSTTVKNSSLLSGFRGGSSYNHETETIFALPRMQLDFKSIHVQEPQEPSLQDAS
Predicted Species
Mouse (99%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1109
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KIAA1109/FSA Recombinant Protein Antigen (NBP1-82145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIAA1109/FSA Antibody

  • FLJ21404
  • Fragile site-associated protein
  • FSADKFZp781P0474
  • KIAA1109
  • KIAA1371
  • MGC110967

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94051
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
NBP2-44814
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-34594
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF4636
Species: Mu
Applications: WB
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-82145
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KIAA1109/FSA Antibody (NBP1-82145) (0)

There are no publications for KIAA1109/FSA Antibody (NBP1-82145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA1109/FSA Antibody (NBP1-82145) (0)

There are no reviews for KIAA1109/FSA Antibody (NBP1-82145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA1109/FSA Antibody (NBP1-82145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KIAA1109/FSA Products

Bioinformatics Tool for KIAA1109/FSA Antibody (NBP1-82145)

Discover related pathways, diseases and genes to KIAA1109/FSA Antibody (NBP1-82145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA1109/FSA Antibody (NBP1-82145)

Discover more about diseases related to KIAA1109/FSA Antibody (NBP1-82145).
 

Pathways for KIAA1109/FSA Antibody (NBP1-82145)

View related products by pathway.

Blogs on KIAA1109/FSA

There are no specific blogs for KIAA1109/FSA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA1109/FSA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1109