KIAA1109/FSA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human kidney shows very weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: KIAA1109/FSA Antibody [NBP1-82145] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

KIAA1109/FSA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VASVKEWFNYVTATRNEELNLLRNVDANNTENSTTVKNSSLLSGFRGGSSYNHETETIFALPRMQLDFKSIHVQEPQEPSLQDAS
• Predicted Species: Mouse (99%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA1109
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KIAA1109/FSA Antibody - BSA Free

• FLJ21404
• Fragile site-associated protein
• FSADKFZp781P0474
• KIAA1109
• KIAA1371
• MGC110967

Background

The KIAA1109 gene is located on the long arm of chromosome 4 in a region that is associated with susceptibility to celiacdisease. The encoded protein is similar to a Chinese hamster protein that is associated with spermatocyte andadipocyte differentiation. The C-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIAA1109/FSA Antibody (NBP1-82145)(1)

Publication using NBP1-82145

• Li X, Chen B, Xu Y et al. Identification of potential diagnostic biomarkers and immune infiltration features in diabetic foot ulcer by bioinformatics analysis and validation Cellular and molecular biology (Noisy-le-Grand, France) 2023-11-15 [PMID: 38015522]

Bioinformatics

• Gene Symbol: KIAA1109