KDM4E Antibody

Immunohistochemistry-Paraffin: KDM4E Antibody [NBP2-49017] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Immunohistochemistry-Paraffin: KDM4E Antibody [NBP2-49017] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: KDM4E Antibody [NBP2-49017] - Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: KDM4E Antibody [NBP2-49017] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Discontinued

KDM4E Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLTLGMSARVLLPSTGSWGSGRGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDM4E
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KDM4E Antibody

• JMJD2E
• KDM4DL
• KDM4D-like protein
• KDM4E
• Lysine (K)-Specific Demethylase 4D-Like
• Lysine (K)-Specific Demethylase 4E
• Lysine-Specific Demethylase 4D-Like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDM4E