KCNT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KCNT2 Antibody [NBP2-14146] - Staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry-Paraffin: KCNT2 Antibody [NBP2-14146] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSD HPLLRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNT2 Protein (NBP2-14146PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNT2 Antibody

  • KCa4.2
  • MGC119610
  • MGC119611
  • MGC119612
  • potassium channel subfamily T member 2
  • potassium channel, subfamily T, member 2
  • Sequence like an intermediate conductance potassium channel subunit
  • SLICKMGC119613
  • SLO2.1
  • sodium activated potassium channel
  • sodium and chloride activated ATP sensitive potassium channel
  • Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1
  • sodium- and chloride-activated ATP-sensitive potassium channel
  • sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32496
Species: Hu
Applications: IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33726
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84934
Species: Hu
Applications: IHC, IHC-P
MAB5657
Species: Hu
Applications: WB, IP, ICC
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBL1-15344
Species: Hu
NBP2-14146
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KCNT2 Antibody (NBP2-14146) (0)

There are no publications for KCNT2 Antibody (NBP2-14146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNT2 Antibody (NBP2-14146) (0)

There are no reviews for KCNT2 Antibody (NBP2-14146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNT2 Antibody (NBP2-14146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNT2 Products

Bioinformatics Tool for KCNT2 Antibody (NBP2-14146)

Discover related pathways, diseases and genes to KCNT2 Antibody (NBP2-14146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNT2 Antibody (NBP2-14146)

Discover more about diseases related to KCNT2 Antibody (NBP2-14146).
 

Pathways for KCNT2 Antibody (NBP2-14146)

View related products by pathway.

Blogs on KCNT2

There are no specific blogs for KCNT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNT2