KCNT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KCNT2 Antibody [NBP2-14146] - Staining of human cell line SH-SY5Y shows localization to vesicles.

Immunohistochemistry-Paraffin: KCNT2 Antibody [NBP2-14146] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNT2 Antibody - BSA Free (NBP2-14146) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCNT2 Protein (NBP2-14146PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCNT2 Antibody - BSA Free

• KCa4.2
• MGC119610
• MGC119611
• MGC119612
• potassium channel subfamily T member 2
• potassium channel, subfamily T, member 2
• Sequence like an intermediate conductance potassium channel subunit
• SLICKMGC119613
• SLO2.1
• sodium activated potassium channel
• sodium and chloride activated ATP sensitive potassium channel
• Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1
• sodium- and chloride-activated ATP-sensitive potassium channel
• sodium-and chloride-activated ATP-sensitive potassium channel (SLICK)

Background

FUCNTION: Outward rectifying potassium channel. Produces rapidly activating outward rectifier K(+) currents. Activated by high intracellular sodium and chloride levels. Channel activity is inhibited by ATP and by inhalation anesthetics, such as isoflurane. Inhibited upon stimulation of G-protein coupled receptors, such as CHRM1 and GRIA1.; Subcellular location: Cell membrane; Multi-pass membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNT2