KCNN3 Recombinant Protein Antigen

Images

 
There are currently no images for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCNN3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNN3.

Source: E. coli

Amino Acid Sequence: NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55459.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNN3 Recombinant Protein Antigen

  • hSK3
  • K3
  • KCa2.3
  • KCa2.3SKCA3small conductance calcium-activated potassium channel protein 3
  • KCNN3
  • potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 3
  • SK3
  • SK3K3
  • SKCa 3
  • SKCa3

Background

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding two different isoforms have been found for this gene. One of the variants lacks the CAG repeat regions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84112
Species: Hu, Pm
Applications: IHC,  IHC-P, WB
NBP3-46425
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-44893
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-33694
Species: Hu
Applications: IHC,  IHC-P
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: COMET, CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Single-Cell Western, WB
NBP2-97681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
7559-ST
Species: Hu
Applications: BA
AF1916
Species: Hu
Applications: ICC, IHC, WB
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-15243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61931
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-79718
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PA, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western

Publications for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP) (0)

There are no publications for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP) (0)

There are no reviews for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNN3 Products

Research Areas for KCNN3 Recombinant Protein Antigen (NBP2-55459PEP)

Find related products by research area.

Blogs on KCNN3

There are no specific blogs for KCNN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCNN3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNN3