KCNN3 Antibody

Images

 
Immunohistochemistry: KCNN3 Antibody [NBP2-14144] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIA DTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSS SS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KCNN3 Protein (NBP2-14144PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNN3 Antibody

  • hSK3
  • KCa2.3SKCA3small conductance calcium-activated potassium channel protein 3
  • potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 3
  • SK3K3
  • SKCa 3
  • SKCa3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46119
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-57340
Species: Hu
Applications: ICC/IF
H00009060-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7559-ST
Species: Hu
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for KCNN3 Antibody (NBP2-14144) (0)

There are no publications for KCNN3 Antibody (NBP2-14144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNN3 Antibody (NBP2-14144) (0)

There are no reviews for KCNN3 Antibody (NBP2-14144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCNN3 Antibody (NBP2-14144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNN3 Products

Bioinformatics Tool for KCNN3 Antibody (NBP2-14144)

Discover related pathways, diseases and genes to KCNN3 Antibody (NBP2-14144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNN3 Antibody (NBP2-14144)

Discover more about diseases related to KCNN3 Antibody (NBP2-14144).
 

Pathways for KCNN3 Antibody (NBP2-14144)

View related products by pathway.

PTMs for KCNN3 Antibody (NBP2-14144)

Learn more about PTMs related to KCNN3 Antibody (NBP2-14144).

Blogs on KCNN3

There are no specific blogs for KCNN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNN3