KCNK5 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KCNK5. Peptide sequence: HKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEETYN The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNK5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for KCNK5 Antibody - BSA Free
Background
KCNK5 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Publications for KCNK5 Antibody (NBP2-85136) (0)
There are no publications for KCNK5 Antibody (NBP2-85136).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNK5 Antibody (NBP2-85136) (0)
There are no reviews for KCNK5 Antibody (NBP2-85136).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCNK5 Antibody (NBP2-85136) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCNK5 Products
Research Areas for KCNK5 Antibody (NBP2-85136)
Find related products by research area.
|
Blogs on KCNK5