KCNK16 Antibody

Product Discontinued

KCNK16 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QSRDQFQLEKLRFLENYTCLDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western Blot reported in scientific literature (PMID: 28928238).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29402588).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCNK16 Antibody

• K2p16.1
• pancreatic potassium channel Talk-1
• potassium channel, subfamily K, member 16
• TALK1

Background

The protein encoded by the KCNK16 gene belongs to the family of potassium channel proteins containing two pore-forming Pdomains. This channel is an open rectifier which primarily passes outward current under physiological K+concentrations. This gene is expressed predominantly in the pancreas and is activated at alkaline pH. Severalalternatively spliced transcript variants encoding different isoforms have been identified for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCNK16 Antibody (NBP1-83071)(2)

Publications using NBP1-83071

• Vierra NC, Dickerson MT, Jordan KL et al. TALK-1 reduces delta-cell endoplasmic reticulum and cytoplasmic calcium levels limiting somatostatin secretion. Mol Metab 2018-03-01 [PMID: 29402588] (Mouse)
• Vierra NC, Dadi PK, Milian SC et al. TALK-1 channels control b cell endoplasmic reticulum Ca(2+) homeostasis. Sci Signal. 2017-09-19 [PMID: 28928238] (WB)

Bioinformatics

• Gene Symbol: KCNK16