KCNK16 Antibody

Images

 
Immunohistochemistry: KCNK16 Antibody [NBP1-83071] - Staining of human seminal vesicle shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related KCNK16 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83071
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KCNK16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSRDQFQLEKLRFLENYTCLDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNK16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP1-83071.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNK16 Antibody

  • K2p16.1
  • pancreatic potassium channel Talk-1
  • potassium channel, subfamily K, member 16
  • TALK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92041
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04360
Species: Hu
NBP1-77097
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-41535
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
NBP2-29404
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81571
Species: Hu
Applications: IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-02000
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-46405
Species: Hu
Applications: WB, IHC
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P

Publications for KCNK16 Antibody (NBP1-83071)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for KCNK16 Antibody (NBP1-83071) (0)

There are no reviews for KCNK16 Antibody (NBP1-83071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCNK16 Antibody (NBP1-83071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNK16 Products

KCNK16 NBP1-83071

Bioinformatics Tool for KCNK16 Antibody (NBP1-83071)

Discover related pathways, diseases and genes to KCNK16 Antibody (NBP1-83071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK16 Antibody (NBP1-83071)

Discover more about diseases related to KCNK16 Antibody (NBP1-83071).
 

Pathways for KCNK16 Antibody (NBP1-83071)

View related products by pathway.

Blogs on KCNK16

There are no specific blogs for KCNK16, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNK16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK16