KCNK1 Recombinant Protein Antigen

Images

 
There are currently no images for KCNK1 Protein (NBP1-84987PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

KCNK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNK1.

Source: E. coli

Amino Acid Sequence: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84987.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KCNK1 Recombinant Protein Antigen

  • DPK
  • HOHO1
  • Inward rectifying potassium channel protein TWIK-1
  • K2P1
  • K2p1.1
  • KCNK1
  • KCNO1
  • Potassium channel KCNO1
  • potassium channel subfamily K member 1
  • potassium channel, subfamily K, member 1
  • potassium inwardly-rectifying channel, subfamily K, member 1
  • TWIK1
  • TWIK-1
  • TWIK1HOHO

Background

K+ channels are divided into three subclasses, reflecting the number of transmembrane segments (TMS), which are designated 6TMS, 4TMS and 2TMS. Members of the 4TMS class contain two distinct pore regions, and include TASK, TREK, TRAAK and TWIK. TWIK-1 mRNA is expressed abundantly in brain and at lower levels in lung, kidney and skeletal muscle. The molecular weight of TWIK-1 in mouse brain is 40 kDa under reducing conditions. TWIK-2 shares low sequence homology with other mammalian family group members, and only 34% homology with TWIK-1. Human TWIK-2 is expressed in pancreas, placenta and heart, while mouse TWIK-2 is expressed in liver. TWIK-2 is inhibited by intracellular, but not extracellular, acidification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41535
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP2-34063
Species: Hu
Applications: IHC,  IHC-P
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-84109
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-43541
Species: Hu
Applications: ELISA, WB
NBP1-81571
Species: Hu
Applications: IHC,  IHC-P
NBP1-80271
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-57882
Species: Hu
Applications: ICC/IF
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB

Publications for KCNK1 Protein (NBP1-84987PEP) (0)

There are no publications for KCNK1 Protein (NBP1-84987PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNK1 Protein (NBP1-84987PEP) (0)

There are no reviews for KCNK1 Protein (NBP1-84987PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KCNK1 Protein (NBP1-84987PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNK1 Products

Research Areas for KCNK1 Protein (NBP1-84987PEP)

Find related products by research area.

Blogs on KCNK1

There are no specific blogs for KCNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KCNK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK1