Recombinant Human KCNK1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KCNK1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 265 - 336 of Human KCNK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNK1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KCNK1 Protein

  • DPK
  • HOHO1
  • Inward rectifying potassium channel protein TWIK-1
  • K2P1
  • K2p1.1
  • KCNO1
  • Potassium channel KCNO1
  • potassium channel subfamily K member 1
  • potassium channel, subfamily K, member 1
  • potassium inwardly-rectifying channel, subfamily K, member 1
  • TWIK-1
  • TWIK1HOHO

Background

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-41535
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
NBP2-34063
Species: Hu
Applications: IHC, IHC-P
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-04360
Species: Hu
NBP1-69621
Species: Hu
Applications: WB
NBP1-81571
Species: Hu
Applications: IHC, IHC-P
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-57882
Species: Hu
Applications: ICC/IF
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KCNK1 Partial Recombinant Protein (H00003775-Q01) (0)

There are no publications for KCNK1 Partial Recombinant Protein (H00003775-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNK1 Partial Recombinant Protein (H00003775-Q01) (0)

There are no reviews for KCNK1 Partial Recombinant Protein (H00003775-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNK1 Partial Recombinant Protein (H00003775-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNK1 Products

Bioinformatics Tool for KCNK1 Partial Recombinant Protein (H00003775-Q01)

Discover related pathways, diseases and genes to KCNK1 Partial Recombinant Protein (H00003775-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK1 Partial Recombinant Protein (H00003775-Q01)

Discover more about diseases related to KCNK1 Partial Recombinant Protein (H00003775-Q01).
 

Pathways for KCNK1 Partial Recombinant Protein (H00003775-Q01)

View related products by pathway.

PTMs for KCNK1 Partial Recombinant Protein (H00003775-Q01)

Learn more about PTMs related to KCNK1 Partial Recombinant Protein (H00003775-Q01).

Blogs on KCNK1

There are no specific blogs for KCNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KCNK1 Antibody
NBP1-84987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KCNK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK1