Recombinant Human KCNJ10 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human KCNJ10 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 276-379 of Human KCNJ10

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KCNJ10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KCNJ10 GST (N-Term) Protein

  • ATP-dependent inwardly rectifying potassium channel Kir4.1
  • ATP-sensitive inward rectifier potassium channel 10
  • BIRK-10
  • glial ATP-dependent inwardly rectifying potassium channel KIR4.1
  • Inward rectifier K(+) channel Kir1.2
  • inward rectifier K+ channel KIR1.2
  • KCNJ10
  • KCNJ13-PEN
  • KIR1.2
  • KIR4.1
  • Potassium channel, inwardly rectifying subfamily J member 10
  • potassium inwardly-rectifying channel, subfamily J, member 10
  • SESAME

Background

KCNJ10 - potassium inwardly-rectifying channel, subfamily J, member 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP3-46384
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P
NBP2-57515
Species: Hu
Applications: IHC,  IHC-P
NBP1-83091
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB

Publications for KCNJ10 Partial Recombinant Protein (H00003766-Q01) (0)

There are no publications for KCNJ10 Partial Recombinant Protein (H00003766-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNJ10 Partial Recombinant Protein (H00003766-Q01) (0)

There are no reviews for KCNJ10 Partial Recombinant Protein (H00003766-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNJ10 Partial Recombinant Protein (H00003766-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I would like to know which specific peptide sequence are detected by the antibody? It is only stated in the data sheet that it reacts against a part of the C-terminal part of KIR4.1. Also, do you know if this antibody or any of your other antibodies could be utilized as an intracellular staining of cells for flow cytometry? Furthermore, I have seen in the data sheet for the synthetic peptide that it is not suitable for use with live cells, but is this an absolute? If this is the case, would it possible to buy a similar peptide which could be used with live cells, and if so at which prize/amount? Lastly, are the peptide in a frozen liquid form (or solid powder) with out trace of azide? When it comes to the cell lysate I'm wondering if this could be utilized with live cells or if the RIPA buffer which it is dissolved in makes this very toxic? If the last is the case, is it possible to provide the lysate in another buffer which are appropriate for live cells? Lastly, I wondered if the transfected HEK293T cells are also sold for culture?
    • This partial recombinant protein is produced by a company in Taiwan called Abnova. We distribute their products in addition to selling our own. They have confirmed that this protein has not been tested with live cells, so we do not know whether it would be suitable or not, and that it is supplied frozen, in an azide-free buffer. Unfortunately, an alternative protein/peptide of KCNJ10 is not available. I think this product is supplied frozen not lyophilized, and the buffer is 50 mM Tris-HCI, 10 mM reduced glutathione, pH 8.0.

Additional KCNJ10 Products

Research Areas for KCNJ10 Partial Recombinant Protein (H00003766-Q01)

Find related products by research area.

Blogs on KCNJ10

There are no specific blogs for KCNJ10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KCNJ10 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ10