Recombinant Human KCNJ10 GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 276-379 of Human KCNJ10 Source: Wheat Germ (in vitro) Amino Acid Sequence: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
KCNJ10 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
37.18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human KCNJ10 GST (N-Term) Protein
Background
KCNJ10 - potassium inwardly-rectifying channel, subfamily J, member 10
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Publications for KCNJ10 Partial Recombinant Protein (H00003766-Q01) (0)
There are no publications for KCNJ10 Partial Recombinant Protein (H00003766-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNJ10 Partial Recombinant Protein (H00003766-Q01) (0)
There are no reviews for KCNJ10 Partial Recombinant Protein (H00003766-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCNJ10 Partial Recombinant Protein (H00003766-Q01). (Showing 1 - 1 of 1 FAQ).
-
I would like to know which specific peptide sequence are detected by the antibody? It is only stated in the data sheet that it reacts against a part of the C-terminal part of KIR4.1. Also, do you know if this antibody or any of your other antibodies could be utilized as an intracellular staining of cells for flow cytometry? Furthermore, I have seen in the data sheet for the synthetic peptide that it is not suitable for use with live cells, but is this an absolute? If this is the case, would it possible to buy a similar peptide which could be used with live cells, and if so at which prize/amount? Lastly, are the peptide in a frozen liquid form (or solid powder) with out trace of azide? When it comes to the cell lysate I'm wondering if this could be utilized with live cells or if the RIPA buffer which it is dissolved in makes this very toxic? If the last is the case, is it possible to provide the lysate in another buffer which are appropriate for live cells? Lastly, I wondered if the transfected HEK293T cells are also sold for culture?
- This partial recombinant protein is produced by a company in Taiwan called Abnova. We distribute their products in addition to selling our own. They have confirmed that this protein has not been tested with live cells, so we do not know whether it would be suitable or not, and that it is supplied frozen, in an azide-free buffer. Unfortunately, an alternative protein/peptide of KCNJ10 is not available. I think this product is supplied frozen not lyophilized, and the buffer is 50 mM Tris-HCI, 10 mM reduced glutathione, pH 8.0.
Additional KCNJ10 Products
Research Areas for KCNJ10 Partial Recombinant Protein (H00003766-Q01)
Find related products by research area.
|
Blogs on KCNJ10