Recombinant Human KCNE1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KCNE1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 105 of Human KCNE1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KCNE1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KCNE1 Protein

  • Delayed rectifier potassium channel subunit IsK
  • FLJ18426
  • FLJ38123
  • IKs producing slow voltage-gated potassium channel subunit beta Mink
  • ISK
  • Isk-related subfamily, member 1
  • JLNS2FLJ94103
  • LQT2/5
  • MGC33114
  • Minimal potassium channel
  • MinK
  • potassium voltage-gated channel, Isk-related family, member 1
  • voltage gated potassiun channel accessory subunit

Background

KCNE1( AAH36452, 1 a.a. - 106 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12155
Species: Hu
NBP2-19315
Species: Hu
Applications: WB
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KCNE1 Recombinant Protein (H00003753-P01) (0)

There are no publications for KCNE1 Recombinant Protein (H00003753-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNE1 Recombinant Protein (H00003753-P01) (0)

There are no reviews for KCNE1 Recombinant Protein (H00003753-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNE1 Recombinant Protein (H00003753-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNE1 Products

Bioinformatics Tool for KCNE1 Recombinant Protein (H00003753-P01)

Discover related pathways, diseases and genes to KCNE1 Recombinant Protein (H00003753-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNE1 Recombinant Protein (H00003753-P01)

Discover more about diseases related to KCNE1 Recombinant Protein (H00003753-P01).
 

Pathways for KCNE1 Recombinant Protein (H00003753-P01)

View related products by pathway.

PTMs for KCNE1 Recombinant Protein (H00003753-P01)

Learn more about PTMs related to KCNE1 Recombinant Protein (H00003753-P01).

Blogs on KCNE1

There are no specific blogs for KCNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KCNE1 Antibody (5B12)
H00003753-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KCNE1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE1