KChIP2 Antibody - BSA Free

Immunohistochemistry: KChIP2 Antibody [NBP3-10370] - Immunohistochemical analysis of human brain

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KChIP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KChIP2 Antibody - BSA Free (NBP3-10370) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KChIP2 (NP_775285). Peptide sequence QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KChIP2 Antibody - BSA Free

• A-type potassium channel modulatory protein 2
• cardiac voltage gated potassium channel modulatory subunit
• Cardiac voltage-gated potassium channel modulatory subunit
• DKFZp566L1246
• KChIP2
• KCHIP2Kv channel-interacting protein 2
• Kv channel interacting protein 2
• MGC17241
• potassium channel interacting protein 2
• Potassium channel-interacting protein 2

Background

KChIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNIP2