KANK2 Antibody

Images

 
Western Blot: KANK2 Antibody [NBP2-87652] - WB Suggested Anti-KANK2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Product Details

Summary
Reactivity Hu, Bv, Ca, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KANK2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of KANK2. Peptide sequence: DSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQ The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (93%), Equine (93%), Canine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
KANK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KANK2 Antibody

  • ANKRD25
  • ankyrin repeat domain 25
  • Ankyrin repeat domain-containing protein 25
  • DKFZp434N161
  • FLJ20004
  • KIAA1518SRC1-interacting protein
  • kidney ankyrin repeat-containing protein 2
  • KN motif and ankyrin repeat domain-containing protein 2
  • KN motif and ankyrin repeat domains 2
  • Matrix-remodeling-associated protein 3
  • matrix-remodelling associated 3
  • MGC119707
  • MXRA3
  • SIP
  • SRC-1 interacting protein
  • SRC-1-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-82991
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP3-05160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-45831
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-87652
Species: Hu, Bv, Ca, Eq
Applications: WB

Publications for KANK2 Antibody (NBP2-87652) (0)

There are no publications for KANK2 Antibody (NBP2-87652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KANK2 Antibody (NBP2-87652) (0)

There are no reviews for KANK2 Antibody (NBP2-87652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KANK2 Antibody (NBP2-87652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KANK2 Products

Array NBP2-87652

Bioinformatics Tool for KANK2 Antibody (NBP2-87652)

Discover related pathways, diseases and genes to KANK2 Antibody (NBP2-87652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KANK2 Antibody (NBP2-87652)

Discover more about diseases related to KANK2 Antibody (NBP2-87652).
 

Pathways for KANK2 Antibody (NBP2-87652)

View related products by pathway.

Blogs on KANK2

There are no specific blogs for KANK2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KANK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KANK2