JWA Antibody

Images

 
Western Blot: JWA Antibody [NBP3-09996] - Western blot analysis of JWA in Mouse Pancreas lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JWA Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JWA (NP_075368.1). Peptide sequence MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for JWA Antibody

  • ADP-ribosylation factor-like protein 6-interacting protein 5
  • ADP-ribosylation-like factor 6 interacting protein 5
  • Aip-5
  • ARL-6-interacting protein 5
  • Cytoskeleton-related vitamin A-responsive protein
  • Dermal papilla-derived protein 11
  • DERP11addicsin
  • Glutamate transporter EAAC1-interacting protein
  • glutamate transporter EEAC1-associated protein
  • GTRAP3-18aip-5
  • hp22
  • HSPC127
  • JM5
  • jmx
  • JWAcytoskeleton related vitamin A responsive protein
  • PRA1 domain family 3
  • PRA1 family protein 3
  • PRA2
  • PRAF3dermal papilla derived protein 11
  • Prenylated Rab acceptor protein 2
  • Protein JWa
  • putative MAPK activating protein PM27
  • Putative MAPK-activating protein PM27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75476
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87886
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-80883
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-75477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-89867
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67455
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77198
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
NBP3-09996
Species: Mu
Applications: WB

Publications for JWA Antibody (NBP3-09996) (0)

There are no publications for JWA Antibody (NBP3-09996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JWA Antibody (NBP3-09996) (0)

There are no reviews for JWA Antibody (NBP3-09996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JWA Antibody (NBP3-09996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional JWA Products

Array NBP3-09996

Bioinformatics Tool for JWA Antibody (NBP3-09996)

Discover related pathways, diseases and genes to JWA Antibody (NBP3-09996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JWA Antibody (NBP3-09996)

Discover more about diseases related to JWA Antibody (NBP3-09996).
 

Pathways for JWA Antibody (NBP3-09996)

View related products by pathway.

PTMs for JWA Antibody (NBP3-09996)

Learn more about PTMs related to JWA Antibody (NBP3-09996).
 

Research Areas for JWA Antibody (NBP3-09996)

Find related products by research area.

Blogs on JWA

There are no specific blogs for JWA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JWA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP5