JMJD5 Antibody - BSA Free

Western Blot: JMJD5 Antibody [NBP2-82260] - WB Suggested Anti-JMJD5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Liver

Chromatin Immunoprecipitation: JMJD5 Antibody [NBP2-82260] - Chromatin Immunoprecipitation (ChIP) Using JMJD5 antibody - middle region and HCT116 Cells

Western Blot: JMJD5 Antibody [NBP2-82260] - Host: Rabbit. Target Name: JMJD5. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

JMJD5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit JMJD5 Antibody - BSA Free (NBP2-82260) is a polyclonal antibody validated for use in WB and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD5. Peptide sequence: LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDM8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for JMJD5 Antibody - BSA Free

• EC 1.14.11.27
• EC 1.14.11.73
• EC 3.4.-.-
• FLJ13798
• JmjC domain-containing protein 5
• JMJD5
• jumonji domain containing 5
• Jumonji domain-containing protein 5
• KDM8
• lysine-specific demethylase 8

Background

JMJD5 is a putative histone lysine demethylase that contains a Jumonji C (JmjC) domain (Shi, 2007 [PubMed 17909537]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KDM8