Reactivity | MuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Concentration | 0.5 mg/ml |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of mouse JDP2. Peptide sequence: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL The peptide sequence for this immunogen was taken from within the described region. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | JDP2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for JDP2 Antibody (NBP2-85122)Find related products by research area.
|
Chromatin reader domains of DNMT-targeting protein, UHRF1, are responsible for cancerous DNA hypermethylation By Jamshed Arslan, Pharm. D., PhD. DNA methylation represses transcription of many genes, including tumor suppressor genes. A protein called UHRF1 recruits DNA methyltransferases (DNMTs) to establish and maintain DNA... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | JDP2 |